PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do017150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 324aa    MW: 34477.3 Da    PI: 4.5326
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do017150.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.81e-373288561
      zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                a +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  Do017150.1 32 APNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 88
                568***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-371587IPR003851Zinc finger, Dof-type
PfamPF027019.6E-323287IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8543387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MLSSHHEAML PYAPRPPSLL VDRRYKQGGE TAPNCPRCDS PNTKFCYYNN YSLSQPRYFC  60
KGCRRYWTKG GSLRNVPVGG GCRKNRRGKS SVRSAAESIS SGRDAAFGHR FPGPVRPDLV  120
LEGMVGNPAN PGQLAIPDVP AAADGSTIDL AMLYAKFLNN PAGEVGVGAV TPESAGQVDE  180
AFDTFSASSD LSPGVLASAQ FDPCHDGFVE WSGPVSSTDP TSTASTSTTT TMLCSDMSVQ  240
AALGELNFAM DQSCFDSLGF PTDVGNLSSW CSIVPSLSTL EADTKYDSLD SFPDDALSLH  300
EGIISGPDHD WSVDCQGLEA LYMP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824080.0KC582408.1 Sorghum bicolor dof11 protein (dof11) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970693.10.0PREDICTED: uncharacterized protein LOC101752604
TrEMBLK3XK070.0K3XK07_SETIT; Uncharacterized protein
STRINGSi002230m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.18e-36Dof family protein